PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_5920V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 334aa    MW: 36518.2 Da    PI: 7.9453
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_5920V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.12e-2771121151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                        k+ien + rqvtfskRr g+lKKA+EL vLCda+va+iifsstgkl+e++s
  Pp3c17_5920V3.1.p  71 KKIENPTSRQVTFSKRRGGLLKKAHELAVLCDADVALIIFSSTGKLFEFAS 121
                        68***********************************************86 PP

2K-box89.56.3e-301442301399
              K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        ++  l +e+ kL++e+e Lq++qRh+lGedL+ L++ +L qLeqqL+ + +++R++Kn+llle+ieel++ke++l+  n++Lr++l+
  Pp3c17_5920V3.1.p 144 NSDFLGREVVKLRQELERLQHSQRHMLGEDLQVLTVPDLLQLEQQLDMGASRVRARKNQLLLEEIEELRRKEHDLHAVNEELRQRLA 230
                        5667889*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-4263122IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.70263123IPR002100Transcription factor, MADS-box
CDDcd002651.15E-4564141No hitNo description
SuperFamilySSF554551.02E-3364150IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-306585IPR002100Transcription factor, MADS-box
PROSITE patternPS00350065119IPR002100Transcription factor, MADS-box
PfamPF003196.6E-2672119IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-3085100IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-30100121IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.13145235IPR002487Transcription factor, K-box
PfamPF014861.6E-27145229IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MMTASGQCKS LCFSLSLNSS NKGSLELLGR GLESGGGCDV VTADSSSPGV GKVDPPKERE  60
VVMGRGKIEI KKIENPTSRQ VTFSKRRGGL LKKAHELAVL CDADVALIIF SSTGKLFEFA  120
SSGSMRDILE RYSKCPDGSQ TGVNSDFLGR EVVKLRQELE RLQHSQRHML GEDLQVLTVP  180
DLLQLEQQLD MGASRVRARK NQLLLEEIEE LRRKEHDLHA VNEELRQRLA DVKGMLSLEA  240
GPARAATSGS PGGQGVSAPT HEVGGSSQQQ AVTVYPTRIN LRDPQTSQTS LHLGLFPESF  300
MPSTSRRPSQ QSPTEPEGES SMRWEHSHYR SQK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J5e-2064148184Myocyte-specific enhancer factor 2A
3p57_I5e-2064148184Myocyte-specific enhancer factor 2A
3p57_D5e-2064148184Myocyte-specific enhancer factor 2A
3p57_C5e-2064148184Myocyte-specific enhancer factor 2A
3p57_B5e-2064148184Myocyte-specific enhancer factor 2A
3p57_A5e-2064148184Myocyte-specific enhancer factor 2A
3kov_J5e-2064148184Myocyte-specific enhancer factor 2A
3kov_I5e-2064148184Myocyte-specific enhancer factor 2A
3kov_B5e-2064148184Myocyte-specific enhancer factor 2A
3kov_A5e-2064148184Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.164760.0protonema
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0777131e-139EF077713.1 Physcomitrella patens MADS-domain transcription factor (PPMC5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001757114.10.0MIKCC MADS-domain protein PPMC5
TrEMBLA9RSQ10.0A9RSQ1_PHYPA; MIKCC MADS-domain protein PPMC5
STRINGPP1S209_130V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.15e-50MIKC_MADS family protein